Human recombinant UGRP1 (from E. coli)
: Biorbyt
- Conjugation:Unconjugated
- Protein/peptide type:Recombinant
- Source:E. coli
- Species:Human
- Storage conditions:Store at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.
- Protein synonyms:Secretoglobin Family 3A Member 2
- UniProtKB:Q96PL1 (Human)
- Protein/peptide name:UGRP1
- Purity:>95% as determined by reducing SDS-PAGE.
- Sequence:FLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCVNELGPEASEAVKKLL EALSHLV
- Formulation:Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
- Tested applications:SDS-PAGE
Frequently Bought Together