Human recombinant IL11 (from P. pastoris)
: Biorbyt
- Conjugation:Unconjugated
- Protein/peptide type:Recombinant
- Source:P. pastoris
- Species:Human
- Storage conditions:Store at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.
- Biological activity:ED50 is less than 0.2 ng/ml as determined by the dosedependent stimulation of murine 7TD1 proliferation.
Specific Activity of 8.0 x 106 IU/ mg. - Protein synonyms:Interleukin11
- UniProtKB:P20809 (Human)
- Protein/peptide name:IL11
- Purity:>95% as determined by reducing SDS-PAGE.
- Sequence:GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGA LQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQP PPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
- Formulation:Lyophilized from a 0.2 um filtered solution of 20mM PB, 2% Glycine, pH 7.2.
- Tested applications:SDS-PAGE , FuncS
Frequently Bought Together