Anti-SLC6A15 Rabbit Polyclonal Antibody
Catalog # ABNOPAB20440
Nome del fornitore: Abnova
Specifiche
- Antibody type:Primary
- Antigen name:Solute Carrier Family 6 (neutral amino acid transporter) Member 15
- Antigen symbol:Solute carrier family 6, member 15
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Cross adsorption:No
- Format:Liquid
- Gene ID:55117
- Antigen synonyms:NTT73|Transporter v7-3|Sodium-coupled branched-chain amino-acid transporter 1|SLC6A15|SBAT1|Solute carrier family 6 member 15|Sodium-dependent neutral amino acid transporter B(0)AT2|B0AT2
- Storage buffer:PBS, pH 7,5 (40% glycerol, 0,02% sodium azide)
- Sequence:RELDDDVTESVKDLLSNEDAADDAFKTSELIVDGQEEKDTDVEEGSEVEDERPAWNSKLQ
- Storage temperature:Store at 4 °C. For long term storage store at –20 °C. Aliquot to avoid repeated freezing and thawing.
- Immunogen:Recombinant protein corresponding to amino acids of human SLC6A15.
- Purification:Antigen affinity purification
- Size:100 μl
- Pk:100 µl
Specifiche
Informazioni su questo articolo
Rabbit polyclonal antibody raised against recombinant SLC6A15.
Recommended Dilutions: Immunohistochemistry: 1:50-1:200
Type: Primary
Antigen: SLC6A15
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human