Anti-EDAR Rabbit Polyclonal Antibody
Catalog # ANTIA9464-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Antibody type:Primary
- Antigen name:Anhidrotic ectodysplasin receptor 1
- Antigen symbol:EDAR
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western blot:Yes
- Gene ID:UniprotID# Q9UNE0
- Antigen synonyms:Ectodysplasin A receptor|ECTD10B|Downless mouse homolog of|Downless homolog|Downless (mouse) homolog|ECTD10A|Ectodysplasin 1 anhidrotic receptor|Ectodermal dysplasia receptor|DL
- Storage buffer:Supplied in phosphate buffered saline, pH 7,30, with 0,02% sodium azide and 50% glycerol
- Molecular weight:48kDa
- Sequence:EYSNCGENEYYNQTTGLCQECPPCGPGEEPYLSCGYGTKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSPFQHAHKELSGQGHLATA
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at ‒20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at +4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 27-187 of human EDAR (NP_071731.1)
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit polyclonal antibody to EDAR for WB with samples derived from Human.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:200
Type: Primary
Antigen: EDAR
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human