Anti-AK3L1 Rabbit Monoclonal Antibody [clone: ARC2572]
Catalog # ANTIA307026-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:Adenylate kinase 3 like 1
- Antigen symbol:AK3L1
- Clonality:Monoclonal
- Clone:ARC2572
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P27144
- Antigen synonyms:GTP:AMP phosphotransferase|adenylate kinase 4|Adenylate kinase isoenzyme 4, mitochondrial|AK3|AK4|AK3L1|ATP-AMP transphosphorylase|Adenylate kinase 3-like|AK3L2
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:27 kDa
- Sequence:MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEAL
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Adenylate kinase 4 (P27144).
- Tested applications:IHC, ICC/IF
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC2572] antibody to AK3L1 for WB, IHC and ICC/IF with samples derived from Human and Rat.
- Validated Applications: WB, IHC, ICC/IF
- Recommended Dilutions: WB: 1:500 to 1:1000, IHC: 1:50 to 1:200, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: AK3L1
Clonality: Monoclonal
Clone: ARC2572
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Rat