Mouse Recombinant IL-19 (from E. coli)
About this item
Interleukin-19 (IL-19) is a member of the interleukin 10 (IL-10) cytokine family and is produced by B cells and monocytes. IL-19 binds the interleukin 20 receptor complex (IL-20R) to activate STAT3 signaling. IL-19 induces interleukin 6 (IL-6) and tumor necrosis factor alpha (TNF-α) expression in monocytes, and promotes type 2 T helper (Th2) cell-mediated immune responses. IL-19 production is upregulated in resting monocytes following granulocyte-macrophage colony-stimulating factor (GM-CSF) or lipopolysaccharide (LPS) stimulation.
- High quality
- Low endotoxin
- Affordable
IL-19 production is upregulated in resting monocytes following granulocyte-macrophage colony-stimulating factor (GM-CSF) or lipopolysaccharide (LPS) stimulation.
Certifications: Animal-Free (AF) proteins are identical to regular proteins and offer additional documentation showing that they were produced with no materials of animal or human origin using ANIMAL-FREE purification processes.
Caution: For research use only.
4 Options Available Below
Product Details & Documents
Interleukin-19 (IL-19) is a member of the interleukin 10 (IL-10) cytokine family and is produced by B cells and monocytes. IL-19 binds the interleukin 20 receptor complex (IL-20R) to activate STAT3 signaling. IL-19 induces interleukin 6 (IL-6) and tumor necrosis factor alpha (TNF-α) expression in monocytes, and promotes type 2 T helper (Th2) cell-mediated immune responses. IL-19 production is upregulated in resting monocytes following granulocyte-macrophage colony-stimulating factor (GM-CSF) or lipopolysaccharide (LPS) stimulation.
- High quality
- Low endotoxin
- Affordable
IL-19 production is upregulated in resting monocytes following granulocyte-macrophage colony-stimulating factor (GM-CSF) or lipopolysaccharide (LPS) stimulation.
Certifications: Animal-Free (AF) proteins are identical to regular proteins and offer additional documentation showing that they were produced with no materials of animal or human origin using ANIMAL-FREE purification processes.
Caution: For research use only.
Specifications for Product Family
Specifications
Specifications
- Catalog No:
- SHBT200-75-100UG
- SHBT200-75-10UG
- SHBT200-75-500UG
- SHBT200-75-1MG
- Protein/peptide name:
- IL-19
- IL-19
- IL-19
- IL-19
- Protein synonyms:
- IL19|IL-19|Interleukin 19
- IL19|IL-19|Interleukin 19
- IL19|IL-19|Interleukin 19
- IL19|IL-19|Interleukin 19
- Protein/peptide type:
- Recombinant
- Recombinant
- Recombinant
- Recombinant
- Protein function:
- Cytokine
- Cytokine
- Cytokine
- Cytokine
- Species:
- Mouse
- Mouse
- Mouse
- Mouse
- Source:
- E. coli
- E. coli
- E. coli
- E. coli
- Conjugation:
- Unconjugated
- Unconjugated
- Unconjugated
- Unconjugated
- Gene ID:
- Q8CJ70
- Q8CJ70
- Q8CJ70
- Q8CJ70
- Sequence:
- MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA
- MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA
- MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA
- MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA
- Protease-free:
- N
- N
- N
- N
- Animal-free:
- N
- N
- N
- N
- Nuclease-free:
- N
- N
- N
- N
- Carrier-free:
- Y
- Y
- Y
- Y
- Endotoxin-free:
- N
- N
- N
- N
- Endotoxin level:
- Low
- Low
- Low
- Low
- Endotoxin content:
- Endotoxin LAL (EU/µg) ≤0.1
- Endotoxin LAL (EU/µg) ≤0.1
- Endotoxin LAL (EU/µg) ≤0.1
- Endotoxin LAL (EU/µg) ≤0.1
- UniProtKB:
- Q8CJ70
- Q8CJ70
- Q8CJ70
- Q8CJ70
- Biological activity:
- Bioactivity: No biological activity data is available at this time
- Bioactivity: No biological activity data is available at this time
- Bioactivity: No biological activity data is available at this time
- Bioactivity: No biological activity data is available at this time
- Purity:
- ≥95%
- ≥95%
- ≥95%
- ≥95%
- Grade:
- RUO
- RUO
- RUO
- RUO
- Formulation:
- 10 mM sodium phosphate, 50 mM sodium chloride, pH 7,5
- 10 mM sodium phosphate, 50 mM sodium chloride, pH 7,5
- 10 mM sodium phosphate, 50 mM sodium chloride, pH 7,5
- 10 mM sodium phosphate, 50 mM sodium chloride, pH 7,5
- Molecular weight:
- 17,7 kDa
- 17,7 kDa
- 17,7 kDa
- 17,7 kDa
- Reconstitution instructions:
- Sterile water at 0,1 mg/ml
- Sterile water at 0,1 mg/ml
- Sterile water at 0,1 mg/ml
- Sterile water at 0,1 mg/ml
- Storage conditions:
- −20 °C
- −20 °C
- −20 °C
- −20 °C
- Shipping temperature:
- RT
- RT
- RT
- RT
Specifications
Product Family Options
Product Information
- Pack typePkAvailabilityPrice
- Specifications:
More
Specifications
Cat. No.SHBT200-75-100UGProtein/peptide nameIL-19Protein synonymsIL19|IL-19|Interleukin 19Protein/peptide typeRecombinantProtein functionCytokineSpeciesMouseSourceE. coliConjugationUnconjugatedGene IDQ8CJ70SequenceMLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAAProtease-freeNAnimal-freeNNuclease-freeNCarrier-freeYEndotoxin-freeNEndotoxin levelLowEndotoxin contentEndotoxin LAL (EU/µg) ≤0.1UniProtKBQ8CJ70Biological activityBioactivity: No biological activity data is available at this timePurity≥95%GradeRUOFormulation10 mM sodium phosphate, 50 mM sodium chloride, pH 7,5Molecular weight17,7 kDaReconstitution instructionsSterile water at 0,1 mg/mlStorage conditions−20 °CShipping temperatureRT - Specifications:
More
Specifications
Cat. No.SHBT200-75-10UGProtein/peptide nameIL-19Protein synonymsIL19|IL-19|Interleukin 19Protein/peptide typeRecombinantProtein functionCytokineSpeciesMouseSourceE. coliConjugationUnconjugatedGene IDQ8CJ70SequenceMLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAAProtease-freeNAnimal-freeNNuclease-freeNCarrier-freeYEndotoxin-freeNEndotoxin levelLowEndotoxin contentEndotoxin LAL (EU/µg) ≤0.1UniProtKBQ8CJ70Biological activityBioactivity: No biological activity data is available at this timePurity≥95%GradeRUOFormulation10 mM sodium phosphate, 50 mM sodium chloride, pH 7,5Molecular weight17,7 kDaReconstitution instructionsSterile water at 0,1 mg/mlStorage conditions−20 °CShipping temperatureRT - Specifications:
More
Specifications
Cat. No.SHBT200-75-500UGProtein/peptide nameIL-19Protein synonymsIL19|IL-19|Interleukin 19Protein/peptide typeRecombinantProtein functionCytokineSpeciesMouseSourceE. coliConjugationUnconjugatedGene IDQ8CJ70SequenceMLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAAProtease-freeNAnimal-freeNNuclease-freeNCarrier-freeYEndotoxin-freeNEndotoxin levelLowEndotoxin contentEndotoxin LAL (EU/µg) ≤0.1UniProtKBQ8CJ70Biological activityBioactivity: No biological activity data is available at this timePurity≥95%GradeRUOFormulation10 mM sodium phosphate, 50 mM sodium chloride, pH 7,5Molecular weight17,7 kDaReconstitution instructionsSterile water at 0,1 mg/mlStorage conditions−20 °CShipping temperatureRT - Specifications:
More
Specifications
Cat. No.SHBT200-75-1MGProtein/peptide nameIL-19Protein synonymsIL19|IL-19|Interleukin 19Protein/peptide typeRecombinantProtein functionCytokineSpeciesMouseSourceE. coliConjugationUnconjugatedGene IDQ8CJ70SequenceMLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAAProtease-freeNAnimal-freeNNuclease-freeNCarrier-freeYEndotoxin-freeNEndotoxin levelLowEndotoxin contentEndotoxin LAL (EU/µg) ≤0.1UniProtKBQ8CJ70Biological activityBioactivity: No biological activity data is available at this timePurity≥95%GradeRUOFormulation10 mM sodium phosphate, 50 mM sodium chloride, pH 7,5Molecular weight17,7 kDaReconstitution instructionsSterile water at 0,1 mg/mlStorage conditions−20 °CShipping temperatureRT
Recommendations will be personalized based on your shopping preferences only if you have given your consent by enabling "Enhance my Shopping Experience" on the "Personal Info page".
Otherwise, you will receive generic recommendations.
Catalog #: 83639.320
Supplier: VWR Chemicals
Catalog #: 20864.320
Supplier: VWR Chemicals
Catalog #: 83640.320
Supplier: VWR Chemicals
Catalog #: 1.00030.2500
Supplier: Merck
Catalog #: 31770.294
Supplier: VWR Chemicals
Catalog #: 83645.320
Supplier: VWR Chemicals
Catalog #: 1.09439.1000
Supplier: Merck