Specifications
- Antigen name:Interferon regulatory factor 5
- Antigen symbol:IRF5
- Clonality:Polyclonal
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Lyophilized
- Gene ID:3663
- Antigen synonyms:SLEB10
- UniProtKB:Q13568
- Storage temperature:At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
- Immunogen:A synthetic peptide corresponding to a sequence at the C-terminus of human IRF5 (442-472aa RLQISNPDLKDRMVEQFKELHHIWQSQQRLQ), different from the related mouse sequence by three amino acids.
- Purification:Immunogen affinity purified.
- Size:100 μg / vial
- Pk:100 µG
Specifications
About this item
Rabbit IgG polyclonal antibody for Interferon regulatory factor 5(IRF5) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Interferon regulatory factor 5, also called IRF5 or SLEB10, is a protein that in humans is encoded by the IRF5 gene. IRF5 gene is mapped to 7q32.1. This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Multiple transcript variants encoding different isoforms have been found for this gene, and a 30-nt indel polymorphism (SNP rs60344245) can result in loss of a 10-aa segment. This gene is a transcription factor involved in the induction of interferons IFNA and INFB and inflammatory cytokines upon virus infection.
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Optimal dilutions should be determined by end users.