Anti-IRF5 Mouse Monoclonal Antibody [clone: 2D4]
Catalog # ABNOH00003663-M05A
Supplier: Abnova
Specifications
- Antibody type:Primary
- Antigen name:Interferon regulatory factor 5
- Antigen symbol:IRF5
- Clonality:Monoclonal
- Clone:2D4
- Conjugation:Unconjugated
- Host:Mouse
- Isotype:IgG1 kappa
- Western blot:Yes
- Cross adsorption:No
- Format:Liquid
- Form:Ascites fluid
- Gene ID:3663
- Antigen synonyms:SLEB10
- Amino acid number:395 to 504
- Sequence:TPPPFEIFFCFGEEWPDRKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDLKDRMVEQFKELHHIWQSQQRLQPVAQAPPGAGLGVGQGPWPMHPAGMQ
- Storage temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunogen:IRF5 (NP_002191, 395 a.a. ~ 504 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Size:200 μl
- Pk:200 µg
Specifications
About this item
Mouse monoclonal antibody raised against a partial recombinant IRF5.
Type: Primary
Antigen: IRF5
Clonality: Monoclonal
Clone: 2D4
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG1 kappa
Reactivity: