Anti-TEAD4 Mouse Monoclonal Antibody [clone: 5H3]
ABNOH00007004-M01A
: Abnova
- Antibody type:Primary
- Antigen name:TEA domain family member 4
- Antigen symbol:TEAD4
- Clonality:Monoclonal
- Clone:5H3
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG2a kappa
- Reactivity:Human
- Western blot:Yes
- Cross adsorption:No
- Form:Liquid
- Gene ID:7004
- Antigen synonyms:TCF13L1|TEFR-1|EFTR-2|TEF-3|RTEF1|TEF3|hRTEF-1B
- Storage buffer:In ascites fluid
- Sequence:ARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDP
- Storage temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Shipping temperature:Ice
- Immunogen:TEAD4 (NP_003204, 151 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Size:200 µl
- Pk:200 µl
Type: Primary
Antigen: TEAD4
Clonality: Monoclonal
Clone: 5H3
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a kappa
Reactivity: Human