Anti-TBX2 Mouse Monoclonal Antibody [clone: 3B2]
Catalog # ABNOH00006909-M02A
Supplier: Abnova
Specifications
- Antibody type:Primary
- Antigen name:T-box 2
- Antigen symbol:TBX2
- Clonality:Monoclonal
- Clone:3B2
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG2a kappa
- Reactivity:Human
- Western blot:Yes
- Environmentally Preferable:
- Cross adsorption:No
- Form:Liquid
- Gene ID:6909
- Antigen synonyms:FLJ10169|T-box protein 2|Tbx2|TBX2|T-box transcription factor TBX2
- Storage buffer:In ascites fluid
- Sequence:GSARPRLRFSPYQIPVTIPPSTSLLTTGLASEGSKAAGGNSREPSPLPELALRKVGAPSRGALSPSGSAKEAANELQSIQRLVSGLESQRALSPGRESPK
- Storage temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Shipping temperature:Ice
- Immunogen:TBX2 (NP_005985, 603 a.a. ~ 702 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Size:200 µl
- Pk:200 µl
Specifications
About this item
Type: Primary
Antigen: TBX2
Clonality: Monoclonal
Clone: 3B2
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a kappa
Reactivity: Human