Anti-ELK1 Rabbit Monoclonal Antibody [clone: ARC0339]
Catalog # ANTIA306016-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Antibody type:Primary
- Antigen name:ELK 1
- Antigen symbol:ELK1
- Clonality:Monoclonal
- Clone:ARC0339
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoPrecipitation:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Environmentally Preferable:
- Form:Liquid
- Gene ID:UniprotID# P19419
- Antigen synonyms:ETS domain containing protein Elk1|ELK1|ELK1_HUMAN|ELK1, ETS transcription factor|ELK1 protein|ELK2 member of ETS oncogene family|ELK1 member of ETS oncogene family|ETS domain containing protein Elk 1|ETS domain protein Elk1
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:62 kDa
- Sequence:GGPGPERTPGSGSGSGLQAPGPALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVVLSPGPQKP
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 329-428 of human ELK1 (P19419).
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC0339] antibody to ELK1 for WB and IP with samples derived from Human, Mouse and Rat.
- Validated Applications: WB, IP
- Recommended Dilutions: WB: 1:500 to 1:2000, IP: 1:500 to 1:1000
Type: Primary
Antigen: ELK1
Clonality: Monoclonal
Clone: ARC0339
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat
Frequently Bought Together