Anti-C Reactive Protein Rabbit Polyclonal Antibody
Catalog # ANTIA11127-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:C Reactive Protein
- Antigen symbol:C Reactive Protein
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P02741
- Antigen synonyms:PTX 1|Pentraxin 1, short|CRP|C-reactive protein(1-205)|pentraxin related|Pentraxin 1|MGC88244|CRP_HUMAN|PTX1
- Storage buffer:Supplied in Phosphate Buffered Saline, pH 7,3, with 50% Glycerol and 0,01% Thiomersal
- Molecular weight:25 kDa
- Sequence:ILFEVPEVTVAPVHICTSWESASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSP
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 100 - 200 of human C - Reactive Protein (CRP) (NP_000558.2)
- Tested applications:ICC/IF
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit polyclonal antibody to C Reactive Protein for WB and ICC/IF with samples derived from human, mouse and rat.
- Validated applications: WB, ICC/IF
- Recommended dilutions: WB: 1:500 to 1:2000, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: C Reactive Protein
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat