Human Recombinant DEFB3 (from E. coli)
Supplier: Biorbyt
Certificates
About this item
Specifications
- Konjugáció:Unconjugated
- Protein/peptide type:Recombinant
- Forrás:E. coli
- Species:Human
- Storage conditions:Store at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.
- Protein synonyms:BetaDefensin 103
- UniProtKB:O15263 (Human)
- Protein/peptide name:DEFB3
- Tisztaság:>95% as determined by reducing SDS-PAGE.
- Szekvencia:GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
- Összeállítás:Lyophilized from a 0.2 um filtered solution of 20mM PB, 130mM NaCl, pH 7.4.
- Tested applications:SDS-PAGE
Specifications
Frequently Bought Together