Human recombinant SUMO1 (from E. coli)
: Biorbyt
- Conjugation:Unconjugated
- Protein/peptide type:Recombinant
- Source:E. coli
- Species:Human
- Storage conditions:Store at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.
- Protein synonyms:Small UbiquitinRelated Modifier 1
- UniProtKB:P63165 (Human)
- Protein/peptide name:SUMO1
- Purity:>95% as determined by reducing SDS-PAGE.
- Sequence:MGSSHHHHHHSSGLVPRGSHMSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLK KLKESYCQRQGVPMNSLRFLFEGQRIADNNTPKELGMEEEDVIEVYQEQTGGHSTV
- Formulation:Lyophilized from a 0.2 um filtered solution of 50mM TrisHCl, 100mM NaCl, 1mM DTT, pH 8.5 .
- Tested applications:SDS-PAGE
Frequently Bought Together
Acetone ≥99%, TECHNICAL
: VWR Chemicals
VWR® Serological Pipette, Standard Line
: VWR Collection
Nitrile gloves, Kimtech™ Purple Nitrile™
: KIMBERLY CLARK
VWR® Facial Tissues
: VWR Collection
VWR®, Nitrile Gloves
: VWR Collection
Water, HiPerSolv CHROMANORM® for HPLC
: VWR Chemicals
VWR® NITRILE LIGHT, Nitrile Gloves
: VWR Collection
VWR®, Transfer Pipettes, High Performance
: VWR Collection