Human Recombinant CCL3 (from E. coli)
Supplier: Biorbyt
Certificates
About this item
Specifications
- Conjugation:Unconjugated
- Protein/peptide type:Recombinant
- Source:E. coli
- Species:Human
- Storage conditions:Store at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.
- Biological activity:ED50 is 3 10 ng/mL as determined by the ability of Recombinant CCL3 to chemoattract human CCR5 transfected BaF3 mouse proB cells.
- Protein synonyms:CC Motif Chemokine 3
- UniProtKB:P10147 (Human)
- Protein/peptide name:CCL3
- Purity:>95% as determined by reducing SDS-PAGE.
- Sequence:SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDL ELSA
- Formulation:Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
- Tested applications:SDS-PAGE , FuncS
Specifications
Frequently Bought Together