Human recombinant GDF3
Supplier: Biorbyt
Certificates
About this item
Specifications
- Protein/peptide type:Recombinant
- Species:Human
- Storage conditions:Store at −20 °C.
- Biological activity:Determined by its ability to inhibit induced alkaline phosphatase production by ATDC-5 chondrogenic cells. The ED50 for this effect is 100-150 ng/ml.
- Protein synonyms:Growth
- UniProtKB:Q9NR23
- Protein/peptide name:GDF3
- Purity:>98%
- Solubility:It is recommended to reconstitute the lyophilized GDF3 in sterile 100mM Acetate buffer pH-4 at concentration of 0.5mg/ml. For the dilution into higher pH values, it is recommended to dilute the protein to concentration of 10ug/ml. Please note that in high
- Sequence:AAIPVPKLSCKNLCHRHQLFINFRDLGWHKWIIAPKGFMANYCHGECPFSLTISLNSSNYAFMQALMHAVDPEIPQAVCIPTKLSPISMLYQDNNDNVILRHYEDMVVDECGCG
- Formulation:The protein was lyophilized from concentrated solution (0.5mg/ml) containing 30mM Acetate buffer pH-4.
- Tested applications:SDS-PAGE
Specifications
Frequently Bought Together