Anti-SLC1A6 Rabbit Polyclonal Antibody
ANTIA9109-100
New Product
- Antibody type:Primary
- Antigen name:EAAT4
- Antigen symbol:SLC1A6
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Gene ID:UniprotID# P48664
- Antigen synonyms:High affinity neuronal glutamate transporter|MGC43671|Solute carrier family 1 (high affinity aspartate/glutamate transporter) member 6|Excitatory amino acid transporter 4|MGC33092|Solute carrier family 1 member 6|Sodium dependent glutamate/aspartate transporter
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,30, with 0,02% Sodium Azide and 50% Glycerol
- Molecular weight:62kDa
- Sequence:PGKGSKEGLHREGRIETIPTADAFMDLIRNMFPPNLVEACFKQFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENVTRALGTLQEMLSFEETVPVPGSANG
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at ‒20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 155-265 of human SLC1A6 (NP_001259016.1)
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit polyclonal antibody to SLC1A6 for WB with samples derived from Human, Mouse and Rat.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:100
Type: Primary
Antigen: SLC1A6
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat