Anti-ETS1 Rabbit Monoclonal Antibody [clone: ARC0082]
ANTIA307447-100
New Product
- Antibody type:Primary
- Antigen name:Avian erythroblastosis virus E26 (v ets) oncogene homolog 1
- Antigen symbol:ETS1
- Clonality:Monoclonal
- Clone:ARC0082
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Rat
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P14921
- Antigen synonyms:ETS1_HUMAN|C ets 1 protein|ETS1 protein|ETS1|c-ets-1|ETS proto-oncogene 1, transcription factor|Ets protein|ETS 1|ETS1 oncogene
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:46 kDa
- Sequence:MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCM
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ETS1 (P14921).
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit monoclonal [ARC0082] antibody to ETS1 for WB with samples derived from Human and Rat.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:2000
Type: Primary
Antigen: ETS1
Clonality: Monoclonal
Clone: ARC0082
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Rat