Anti-EAAT1 Rabbit Monoclonal Antibody [clone: ARC1714]
ANTIA306133-100
New Product
- Antibody type:Primary
- Antigen name:EA6
- Antigen symbol:EAAT1
- Clonality:Monoclonal
- Clone:ARC1714
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P43003
- Antigen synonyms:EAA1_HUMAN|GLAST|GLAST1|Excitatory amino acid transporter 1|GLAST-1|FLJ25094|glutamate/aspartate transporter, high affinity, sodium-dependent|EAAT1|Glial high affinity glutamate transporter
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:50 - 55 kDa/90 - 150 kDa/58 kDa/130 kDa
- Sequence:GTKENMHREGKIVRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPGSVNGVNALGLVVFS
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 150-250 of human EAAT1/SLC1A3 (P43003).
- Tested applications:IHC
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit monoclonal [ARC1714] antibody to EAAT1 for WB and IHC with samples derived from Human, Mouse and Rat.
- Validated Applications: WB, IHC
- Recommended Dilutions: WB: 1:500 to 1:2000, IHC: 1:50 to 1:200
Type: Primary
Antigen: EAAT1
Clonality: Monoclonal
Clone: ARC1714
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat