Anti-CBS Rabbit Monoclonal Antibody [clone: ARC0643]
ANTIA80837-100
New Product
- Antibody type:Primary
- Antigen name:AI047524
- Antigen symbol:CBS
- Clonality:Monoclonal
- Clone:ARC0643
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P35520
- Antigen synonyms:CBS|HIP 4|Beta-thionase|CBS_HUMAN|Cbs cystathionine beta-synthase|Beta thionase|Cystathionine beta synthase|AI303044|EC 4.2.1.22
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% Glycerol, 0,05% BSA, and 0,02% Sodium azide
- Molecular weight:61 kDa
- Sequence:EDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 400-551 of human CBS (P35520)
- Tested applications:IHC, ICC/IF
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit monoclonal [ARC0643] antibody to CBS for WB, IHC and ICC/IF with samples derived from human, mouse and rat.
- Validated applications: WB, IHC, ICC/IF
- Recommended dilutions: WB: 1:500 to 1:2000, IHC: 1:50 to 1:200, ICC/IF: 1:50 to 1:20
Type: Primary
Antigen: CBS
Clonality: Monoclonal
Clone: ARC0643
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat