Anti-ZBTB20 Mouse Monoclonal Antibody [clone: 1F3]
ABNOH00026137-M01
: Abnova
- Antibody type:Primary
- Antigen name:Zinc Finger and BTB Domain Containing 20
- Antigen symbol:ZBTB20
- Clonality:Monoclonal
- Clone:1F3
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- ImmunoFluorescence:Yes
- Isotype:IgG2a kappa
- Reactivity:Human
- Western blot:Yes
- Cross adsorption:No
- Format:Liquid
- Gene ID:26137
- Antigen synonyms:ODA-8S|ZNF288|DPZF|PRIMS|HOF
- Amino acid number:451 to 542
- Storage buffer:1x PBS, pH 7,4
- Sequence:FLFSLPQPLAGQQTQFVTVSQPGLSTFTAQLPAPQPLASSAGHSTASGQGEKKPYECTLCNKTFTAKQNYVKHMFVHTGEKPHQCSICWRSF
- Storage temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunogen:ZBTB20 (NP_056457, 451 a.a. ~ 542 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Size:100 µg
- Pk:100 µg
Mouse monoclonal antibody raised against a partial recombinant ZBTB20.
Recommended Dilutions: Western Blot: 1-5 ?g/ml
Type: Primary
Antigen: ZBTB20
Clonality: Monoclonal
Clone: 1F3
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a kappa
Reactivity: Human