Anti-NR1H3 Rabbit Polyclonal Antibody
Catalog # ABGEAP9952A
Supplier: Abgent
Specifications
- Antibody type:Primary
- Antigen name:Nuclear Receptor Subfamily 1, Group H, Member 3
- Antigen symbol:NR1H3
- Clonality:Polyclonal
- Conjugation:Unconjugated
- ELISA:Yes
- Flow cytometry:Yes
- Host:Rabbit
- ImmunoChemistry:Yes
- Reactivity:Human
- Western blot:Yes
- Epitope:middle
- Gene ID:3146
- Antigen synonyms:LXRA|Oxysterols receptor LXR-alpha|LXR-a|Liver X receptor alpha|LXR-A|RLD-1
- Storage buffer:PBS with 0,09% (W/V) sodium azide, pH 7,4
- Sequence:MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
- Storage temperature:Maintain refrigerated at 2-8 °C for up to 6 months. For long term storage store at –20 °C in small aliquots to prevent freeze-thaw cycles
- Concentration:0,37 mg/ml
- Shipping temperature:4 °C
- Immunogen:This HMGB1 antibody is generated from rabbits immunized with human HMGB1 recombinant protein.
- Purification:Protein A & Peptide affinity purification
- Pk:400 µl
Specifications
About this item
Type: Primary
Antigen: NR1H3 (nuclear receptor subfamily 1, group H, member 3)
Clonality: polyclonal
Clone:
Conjugation: unconjugated
Epitope: middle
Host: Rabbit
Isotype: none
Reactivity: Human