- Antigen name:monoamine oxidase A
- Antigen symbol:MAOA
- Clonality:Polyclonal
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Lyophilized
- Gene ID:4128
- Antigen synonyms:MAO-A
- UniProtKB:P21397
- Storage temperature:At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
- Immunogen:A synthetic peptide corresponding to a sequence at the C-terminus of human MAOA (457-493aa REVLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWER), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids.
- Purification:Immunogen affinity purified.
- Size:100 μg / vial
- Pk:100 µG
Rabbit IgG polyclonal antibody for Amine oxidase [flavin-containing] A(MAOA) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
MAOA(Monoamine oxidase A), also known as AMINE OXIDASE (FLAVIN-CONTAINING) A, is an enzyme that in humans is encoded by the MAO-A gene. MAOA is an isozyme of monoamine oxidase which is also mapped on Xp11.3. MAOA degrades amine neurotransmitters, such as dopamine, norepinephrine, and serotonin. The protein localizes to the outer mitochondrial membrane. Mutation in MAOA results in monoamine oxidase deficiency, or Brunner syndrome. In humans, there is a 30-base repeat sequence repeated in one of several different numbers of times in the promoter region of the gene coding for MAOA. MAO-A levels in the brain as measured using positron emission tomography are elevated by an average of 34% in patients with major depressive disorder. Inhibition of MAOA prevented apoptosis, and serum starvation of cortical brain cells from Maoa-deficient mice resulted in reduced apoptosis compared with wildtype mice.
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Optimal dilutions should be determined by end users.