Anti-HBEGF Mouse Monoclonal Antibody [clone: 2D10]
Catalog # ABNOH00001839-M03
Supplier: Abnova
Specifications
- Antibody type:Primary
- Antigen name:heparin-binding EGF-like growth factor
- Antigen symbol:HBEGF
- Clonality:Monoclonal
- Clone:2D10
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG1 kappa
- Reactivity:Human
- Western blot:Yes
- Cross adsorption:No
- Format:Liquid
- Gene ID:1839
- Antigen synonyms:DTR|HEGFL|DTS|DTSF
- Amino acid number:20 to 208
- Storage buffer:1x PBS, pH 7,4
- Sequence:LVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDVENEEKVKLGMTNSH
- Storage temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunogen:HBEGF (AAH33097.1, 20 a.a. ~ 208 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Size:100 µg
- Pk:100 µg
Specifications
About this item
Mouse monoclonal antibody raised against a full length recombinant HBEGF.
Recommended Dilutions: Western Blot: 1-5 ?g/ml
Type: Primary
Antigen: HBEGF
Clonality: Monoclonal
Clone: 2D10
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG1 kappa
Reactivity: Human