Specifications
- Antibody type:Primary
- Antigen name:Dimethylarginine dimethylaminohydrolase 1
- Antigen symbol:DDAH1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Cross adsorption:No
- Form:Lyophilized
- Gene ID:23576
- Antigen synonyms:HEL-S-16|DDAH
- Storage temperature:At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
- Immunogen:A synthetic peptide corresponding to a sequence at the C-terminus of human DDAH1 (195-226aa QKALKIMQQMSDHRYDKLTVPDDIAANCIYLN), different from the related mouse and rat sequences by one amino acid.
- Size:100 μg
- Pk:100 µG
Specifications
About this item
DDAH1 is knowns as dimethylarginine dimethylaminohydrolase 1 which is mapped to chromosome 1p22 by radiation hybrid and FISH analysis. This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. DDAH1 plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. It widely expressed, especially in liver and kidney.
1. Dayoub, H., Achan, V., Adimoolam, S., Jacobi, J., Stuehlinger, M. C., Wang, B., Tsao, P. S., Kimoto, M., Vallance, P., Patterson, A. J., Cooke, J. P. Dimethylarginine dimethylaminohydrolase regulates nitric oxide synthesis: genetic and physiological evidence.Circulation 108: 3042-3047, 2003.
2. Millatt, L. J., Whitley, G. StJ., Li, D., Leiper, J. M., Siragy, H. M., Carey, R. M., Johns, R. A. Evidence for dysregulation of dimethylarginine dimethylaminohydrolase I in chronic hypoxia-induced pulmonary hypertension. Circulation 108: 1493-1498, 2003.
3. Tran, C. T. L., Fox, M. F., Vallance, P., Leiper, J. M. Chromosomal localization, gene structure, and expression pattern of DDAH1: comparison with DDAH2 and implications for evolutionary origins. Genomics 68: 101-105, 2000.
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.