Anti-Adenosine Receptor A2a Rabbit Polyclonal Antibody
Catalog # ANTIA13527-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen symbol:Adenosine Receptor A2a
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- ImmunoFluorescence:Yes
- Isotype:IgG
- Western blot:Yes
- Seq:1286
- Form:Liquid
- Gene ID:UniprotID# P29274
- Antigen synonyms:ADORA2|ADORA2A
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol and 0,02% sodium azide.
- Molecular weight:43 kDa
- Sequence:IDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRI
- Storage temperature:Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Concentration:Lot specific
- Shipping temperature:Shipped on blue ice at 4 °C.
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 100 - 200 of human ADORA2A (NP_000666.2).
- Tested applications:ICC/IF
- Purification:Affinity purification
- Pack type:Plastic vial
Specifications
About this item
Rabbit polyclonal antibody to Adenosine Receptor A2a for WB and ICC/IF with samples derived from Human, Mouse and Rat.
- Recommended dilutions: WB: 1:500 to 1:1000, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: Adenosine Receptor A2a
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat