Anti-HAL Rabbit Polyclonal Antibody
Catalog # ORIGTA338257
Supplier: OriGene
New Product
Specifications
- Antibody type:Primary
- Antigen name:Histidase
- Antigen symbol:HAL
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Western blot:Yes
- Format:Liquid. Purified antibody supplied in 1X PBS buffer with 0,09% (w/v) sodium azide and 2% sucrose.
- Gene ID:3034
- Antigen synonyms:HSTD|HIS
- Accession no.:NP_002099
- UniProtKB:P42357
- Molecular weight:72 kDa
- Storage temperature:Store at –20 °C as received
- Immunogen:The immunogen for anti-HAL antibody: synthetic peptide directed towards the N terminal of human HAL. Synthetic peptide located within the following region: INKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLET
- Purification:Affinity purified
- Pk:100 µl
Specifications
About this item
Histidine ammonia-lyase is a cytosolic enzyme catalysing the first reaction in histidine catabolism, the nonoxidative deamination of L-histidine to trans-urocanic acid.
Histidine ammonia-lyase defects cause histidinemia which is characterised by increased histidine and histamine and decreased urocanic acid in body fluids. Several transcript variants encoding different isoforms have been found for this gene.