Anti-UGT2B7 Rabbit Polyclonal Antibody
ANTIA8955-100
New Product
- Antibody type:Primary
- Antigen name:3, 3 4 catechol estrogen specific
- Antigen symbol:UGT2B7
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P16662
- Antigen synonyms:UDP glucuronosyltransferase 2B7|UDP glucuronosyltransferase 2 family, member B7|UD2B7_HUMAN|3,4 catechol estrogen specific UDPGT|UDP glucuronosyltransferase 2 family, polypeptide B7|UDP glucuronosyltransferase 2 family, member B9|4-catechol estrogen-specific UDPGT|UDP glucuronosyltransferase 2 family polypeptide B7
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% Glycerol and 0,01% Thiomersal
- Molecular weight:70 kDa
- Sequence:KVLVWAAEYSHWMNIKTILDELIQRGHEVTVLASSASILFDPNNSSALKIEIYPTSLTKTELENFIMQQIKRWSDLPKDTFWLYFSQVQEIMSIFGDITRKFCKDVVSNKKFMKKVQESRFDVIFADAIFPCSELLAELFNIPFVYSLSFSPGYTFEKHSGGFIFPPSYVPVVMSELTDQMTFMERVKNMIYVLYFDFWFEIFDMKKWDQFYSEVLGRPTTLSETMGKADVWLIRNSWNFQFPYPLLPNVDFVGGLHCKPAKPLPKEMEDFVQSSGENGVVVFSLGSMVSNMTEERANVIASALAQIPQKVLWRFDGNKPDTLGLNT
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at ‒20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 25-351 of human UGT2B7 (NP_001065.2)
- Tested applications:ICC/IF
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit polyclonal antibody to UGT2B7 for WB and ICC/IF with samples derived from Human, Mouse and Rat.
- Validated applications: WB, ICC/IF
- Recommended dilutions: WB: 1:500 to 1:2000, ICC/IF: 1:50 to 1:10
Type: Primary
Antigen: UGT2B7
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat