Anti-IL-18 Rabbit Polyclonal Antibody
Catalog # ANTIA8859-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Antibody type:Primary
- Antigen name:Iboctadekin
- Antigen symbol:IL-18
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoPrecipitation:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q14116
- Antigen synonyms:IFN gamma inducing factor|IL-1 gamma|IL 1g|IL 18|IFN-gamma-inducing factor|IGIF|IL1 gamma|IL-18|IL 1 gamma
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% Glycerol and 0,05% Proclin 300
- Molecular weight:22 kDa
- Sequence:KLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTI
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at ‒20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 40-100 of human IL18 (NP_001553.1)
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit polyclonal antibody to IL-18 for WB and IP with samples derived from Human, Mouse and Rat.
- Validated applications: WB, IP
- Recommended dilutions: WB: 1:500 to 1:1000, IP: 1:50 to 1:10
Type: Primary
Antigen: IL-18
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat