Anti-BCMA Rabbit Polyclonal Antibody
Catalog # ANTIA8765-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:B cell maturation antigen
- Antigen symbol:BCMA
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q02223
- Antigen synonyms:B cell maturation factor|CD269|B cell maturation protein|TNFRSF17|TNR17_HUMAN|B-cell maturation protein|BCMA|BCM|CD269 antigen
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% Glycerol and 0,05% Proclin 300
- Molecular weight:15 - 35 kDa
- Sequence:MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAILWTCLGLSLIISLAVFVLMFLLRKINSEPLKDEFKNTGSGLLGMA
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at ‒20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TNFRSF17 (NP_001183.2)
- Tested applications:ICC/IF
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit polyclonal antibody to BCMA for WB and ICC/IF with samples derived from Human, Mouse and Rat.
- Validated applications: WB, ICC/IF
- Recommended dilutions: WB: 1:100 to 1:500, ICC/IF: 1:50 to 1:20
Type: Primary
Antigen: BCMA
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat