Anti-DHHC-20 Rabbit Polyclonal Antibody
ANTIA93356-100
New Product
- Antibody type:Primary
- Antigen name:4933421L13Rik
- Antigen symbol:DHHC-20
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q5W0Z9
- Antigen synonyms:Zinc finger DHHC type containing 20|Zinc finger DHHC domain-containing protein 20|Probable palmitoyltransferase ZDHHC20|DHHC-20|ZDH20_HUMAN
- Storage buffer:Supplied in Phosphate Buffered Saline, pH 7,3, with 50% Glycerol and 0,01% Thiomersal
- Molecular weight:42 kDa
- Sequence:FTIFGNEENGKTVVYLVAFHLFFVMFVWSYWMTIFTSPASPSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSASKTIRYCEKCQLIKPDRAH
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 40-140 of human ZDHHC20 (NP_001316988.1)
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit polyclonal antibody to DHHC-20 for WB with samples derived from Human, Mouse and Rat.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:2,000
Type: Primary
Antigen: DHHC-20
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat