Anti-PRIM1 Rabbit Polyclonal Antibody
ANTIA93303-100
New Product
- Antibody type:Primary
- Antigen name:AI324982
- Antigen symbol:PRIM1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P49642
- Antigen synonyms:p49|DNA primase small subunit|PRIM1|MGC109113|PRI1_HUMAN|DNA primase 49 kDa subunit|MGC107288
- Storage buffer:Supplied in Phosphate Buffered Saline, pH 7,3, with 50% Glycerol and 0,01% Thiomersal
- Molecular weight:49 kDa
- Sequence:CCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKKKVHLSEKIHPFIRKSINIIKKYFEEYALVNQDILENKESWDKILALVPETIHDELQQSFQKSHNSLQRWEHLKKVASRYQNNIKNDKYGPWLEWEIMLQYCFPRLDINVSKGINHLLKSPFSVHPKTGRISVPIDLQKVDQFDPFTVPTISFICRELDAISTNEEEKEENEAESDVKHRTRDYKKTSLAPYVKVFEHFLENLDKSRKGELLKKSDLQKDF
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 121-420 of human PRIM1 (NP_000937.1)
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit polyclonal antibody to PRIM1 for WB with samples derived from Human and Mouse.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:2,000
Type: Primary
Antigen: PRIM1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse