Anti-NOP58 Rabbit Polyclonal Antibody
Catalog # ANTIA9553-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:HSPC120
- Antigen symbol:NOP58
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q9Y2X3
- Antigen synonyms:Nucleolar protein NOP5/NOP58|Nucleolar protein 5|NOP5|NOP58 ribonucleoprotein homolog|NOP58 ribonucleoprotein homolog (yeast)|NOP58_HUMAN|NOL5|NOP5/NOP58|Nucleolar protein 58
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol and 0,02% sodium azide
- Molecular weight:65 kDa
- Sequence:RMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDRGIRKISGTGKALAKTEKYEHKSEVKTYDPSGDSTLPTCSKKRKIEQVDKEDEITEKKAKKAKIKVKVEEEEEEKVAEEEETSVKKKKKRGKKKHIKEEPLSEEEPCTSTAIASPEKKKKKKKKRENED
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at ‒20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at +4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 360-529 of human NOP58 (NP_057018.1)
- Tested applications:ICC/IF
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit polyclonal antibody to NOP58 for WB and ICC/IF with samples derived from Human, Mouse and Rat.
- Validated applications: WB, ICC/IF
- Recommended dilutions: WB: 1:500 to 1:1000, ICC/IF: 1:50 to 1:20
Type: Primary
Antigen: NOP58
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat