Anti-CD44 Rabbit Polyclonal Antibody
ANTIA309094-100
New Product
- Antibody type:Primary
- Antigen name:BA-1
- Antigen symbol:CD44
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Form:Liquid
- Gene ID:UniprotID# P16070
- Antigen synonyms:CD44_HUMAN|CD44|CDw44|CD44 molecule (Indian blood group)|chondroitin sulfate proteoglycan 8|CD 44|Cell surface glycoprotein CD44|CD44 antigen|CD44 molecule
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol and 0,02% sodium azide
- Sequence:VNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATRDQDTFHPSGGSHTTHGSESDGHSH
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 148-247 of human CD44 (NP_001189486.1).
- Tested applications:ICC/IF
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit polyclonal antibody to CD44 for ICC/IF with samples derived from human, mouse and rat.
- Validated applications: ICC/IF
- Recommended dilutions: ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: CD44
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat