Anti-RPE65 Rabbit Monoclonal Antibody [clone: ARC1659]
Catalog # ANTIA308904-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:All-trans-retinyl-palmitate hydrolase
- Antigen symbol:RPE65
- Clonality:Monoclonal
- Clone:ARC1659
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q16518
- Antigen synonyms:Retinal pigment epithelium specific 61 kDa protein|Leber congenital amaurosis|p63|LCA 2|mRPE 65|LCA2|rd12|mRPE65|rd 12
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:68 kDa
- Sequence:TIWLEPEVLFSGPRQAFEFPQINYQKYCGKPYTYAYGLGLNHFVPDRLCKLNVKTKETWVWQEPDSYPSEPIFVSHPDALEEDDGVVLSVVVSPGAGQKPA
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 400-500 of human RPE65 (Q16518).
- Tested applications:IHC, ICC/IF
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC1659] antibody to RPE65 for WB, IHC and ICC/IF with samples derived from mouse and rat.
- Validated applications: WB, IHC, ICC/IF
- Recommended dilutions: WB: 1:500 to 1:2,000, IHC: 1:50 to 1:200, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: RPE65
Clonality: Monoclonal
Clone: ARC1659
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Mouse;Rat