Anti-LSP1 Rabbit Monoclonal Antibody [clone: ARC1952]
Catalog # ANTIA308852-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:47 kDa actin binding protein
- Antigen symbol:LSP1
- Clonality:Monoclonal
- Clone:ARC1952
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P33241
- Antigen synonyms:Leufactin|LSP 1|52 kDa phosphoprotein|Leukocyte F actin binding protein|47 kDa actin-binding protein|LSP1|F actin binding and cytoskeleton associated protein|Leukocyte specific protein 1|Leufactin (leukocyte F-actin binding protein)
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:47 kDa
- Sequence:TAGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKTPSCKDIVAGDMSKKSLWEQKGGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPAP
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 240-339 of human LSP1 (P33241).
- Tested applications:ICC/IF
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC1952] antibody to LSP1 for WB and ICC/IF with samples derived from human, mouse and rat.
- Validated applications: WB, ICC/IF
- Recommended dilutions: WB: 1:500 to 1:2,000, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: LSP1
Clonality: Monoclonal
Clone: ARC1952
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat