Anti-Integrin alpha V Rabbit Monoclonal Antibody [clone: ARC50621]
Catalog # ANTIA308725-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:antigen identified by monoclonal
- Antigen symbol:Integrin alpha V
- Clonality:Monoclonal
- Clone:ARC50621
- Conjugation:Unconjugated
- Flow cytometry:Yes
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P06756
- Antigen synonyms:Integrin alpha-5|CD 51|DKFZp686A08142|Integrin alpha-V light chain|CD51|integrin alpha V beta 3|Integrin alpha V|integrin alpha-V|Integrin alpha five
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,05% Proclin 300
- Molecular weight:140 kDa
- Sequence:SLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 949-1048 of human Integrin alpha V (ITGAV/CD51) (NP_002201.2)
- Tested applications:IHC
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC50621] antibody to Integrin alpha V for WB, IHC and flow cytometry with samples derived from human, mouse and rat.
- Validated applications: WB, IHC, flow cytometry
- Recommended dilutions: WB: 1:500 to 1:2,000, IHC: 1:50 to 1:200, flow cytometry: 1:50 to 1:200
Type: Primary
Antigen: Integrin alpha V
Clonality: Monoclonal
Clone: ARC50621
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat