Anti-IL-10 Rabbit Polyclonal Antibody
ANTIA308703-100
New Product
- Antibody type:Primary
- Antigen name:CSIF
- Antigen symbol:IL-10
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Rat
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P29456
- Antigen synonyms:IL10A|Interleukin 10|IL 10|IL-10|Cytokine synthesis inhibitory factor|GVHDS|IL10_HUMAN|Interleukin-10|IL10
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol and 0,05% Proclin 300
- Molecular weight:18 kDa
- Sequence:SKGHSIRGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNILLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLWIQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 19-178 of rat Rat IL10 (NP_036986.2)
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit polyclonal antibody to IL-10 for WB with samples derived from rat.
- Validated applications: WB
- Recommended dilutions: WB: 1:100 to 1:500
Type: Primary
Antigen: IL-10
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Rat