Anti-ICAM1 Rabbit Polyclonal Antibody
ANTIA9725-100
New Product
- Antibody type:Primary
- Antigen name:Antigen identified by monoclonal
- Antigen symbol:ICAM1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P05362
- Antigen synonyms:Human rhinovirus receptor|CD54 antigen|Cell surface glycoprotein P3.58|BB2|CD54|CD_antigen=CD54|BB 2|CD 54|ICAM 1
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% Glycerol and 0,05% Proclin 300
- Molecular weight:89 kDa/92 kDa
- Sequence:PLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKP
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at ‒20 °C. Avoid freeze / thaw cycles.
- Shipping temperature:Shipped on blue ice at +4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 120-320 of human ICAM-1/CD54 (NP_000192.2)
- Tested applications:IHC, ICC/IF
- Purification:Affinity purification.
- Pack type:Plastic vial
- Pk:100 µl
Rabbit polyclonal antibody to ICAM1 for WB, IHC and ICC/IF with samples derived from Human, Mouse and Rat.
- Validated Applications: WB, IHC, ICC/IF
- Recommended Dilutions: WB: 1:1000 to 1:5000, IHC: 1:50 to 1:200, ICC/IF: 1:50 to 1:20
Type: Primary
Antigen: ICAM1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat