Anti-WIPI1 Rabbit Monoclonal Antibody [clone: ARC1652]
ANTIA307185-100
New Product
- Antibody type:Primary
- Antigen name:ATG 18
- Antigen symbol:WIPI1
- Clonality:Monoclonal
- Clone:ARC1652
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q5MNZ9
- Antigen synonyms:ATG18A|WD repeat domain phosphoinositide interacting protein 1|FLJ10055|WD40 repeat protein interacting with phosphoinositides of 49 kDa|Atg18 protein homolog|WD repeat domain phosphoinositide interacting 1|ATG18|WD repeat domain phosphoinositide-interacting protein 1|WD40 repeat protein interacting with phosphoInositides of 49kDa
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:49 kDa
- Sequence:MEAEAADAPPGGVESALSCFSFNQDCTSLATGTKAGYKLFSLSSVEQLDQVHGSNEIPDVYIVERLFSSSLVVVVSHTKPRQMNVYHFKKGTEICNYSYS
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 1-100 of human WIPI1 (Q5MNZ9).
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit monoclonal [ARC1652] antibody to WIPI1 for WB with samples derived from Human, Mouse and Rat.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:2000
Type: Primary
Antigen: WIPI1
Clonality: Monoclonal
Clone: ARC1652
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat