Anti-MVP Rabbit Monoclonal Antibody [clone: ARC1855]
Catalog # ANTIA307056-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:LRP
- Antigen symbol:MVP
- Clonality:Monoclonal
- Clone:ARC1855
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q14764
- Antigen synonyms:MVP|VAULT1|Major vault protein|Major vault protein, rat, homolog of|VAULT 1|MVP_HUMAN|Lung resistance-related protein|testicular secretory protein Li 30|Lung resistance related protein
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:100 kDa
- Sequence:MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRMVTVPPRHYCTVANPVSRDAQGLVLFDVTGQVRLRHADLEIRLAQDPFPLY
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MVP (Q14764).
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC1855] antibody to MVP for WB with samples derived from Human, Mouse and Rat.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:2000
Type: Primary
Antigen: MVP
Clonality: Monoclonal
Clone: ARC1855
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat