Anti-PMP70 Rabbit Polyclonal Antibody
Catalog # ANTIA306728-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:70 kDa peroxisomal membrane protein
- Antigen symbol:PMP70
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P28288
- Antigen synonyms:ABCD 3|ABCD3 protein|ABC 43|ABC D3|ATP binding cassette sub family D (ALD) member 3|ABC43|ABCD3_HUMAN|ATP binding cassette sub family D member 3|Abcd3
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol and 0,01% Thiomersal
- Molecular weight:70 kDa
- Sequence:LSHPRHLKSTHSELLEDYYQSGRMLLRMSQALGRIVLAGREMTRLAGFTARITELMQVLKDLNHGKYERTMVSQQEKGIEGVQVIPLIPGAGEIIIADNIIKFDHVPLATPNGDVLIRDLNFEVRSGANVLICGPN
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 340-475 of human PMP70/ABCD3 (NP_002849.1).
- Tested applications:IHC, ICC/IF
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit polyclonal antibody to PMP70 for WB, IHC and ICC/IF with samples derived from Human, Mouse and Rat.
- Validated Applications: WB, IHC, ICC/IF
- Recommended Dilutions: WB: 1:500 to 1:1000, IHC: 1:50 to 1:200, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: PMP70
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat