Anti-MCM4 Rabbit Monoclonal Antibody [clone: ARC1491]
Catalog # ANTIA306597-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:19G
- Antigen symbol:MCM4
- Clonality:Monoclonal
- Clone:ARC1491
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P33991
- Antigen synonyms:CDC 54|AU045576|AI325074|CDC54|CDC21|CDC 21|CDC21, S. pombe, homolog of|Cell division cycle 21, S. pombe, homolog of|CDC21 homolog
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:97 kDa
- Sequence:LHREALKQSATDPRTGIVDISILTTGMSATSRKRKEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITKDMFEEALRALADDDFLTVTGKTVRLL
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 764-863 of human MCM4 (P33991).
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC1491] antibody to MCM4 for WB with samples derived from Human, Mouse and Rat.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:2000
Type: Primary
Antigen: MCM4
Clonality: Monoclonal
Clone: ARC1491
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat