Anti-PMP70 Rabbit Monoclonal Antibody [clone: ARC2131]
Catalog # ANTIA306158-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:70 kDa peroxisomal membrane protein
- Antigen symbol:PMP70
- Clonality:Monoclonal
- Clone:ARC2131
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P28288
- Antigen synonyms:ABCD 3|ABCD3 protein|ABC 43|ABC D3|ATP binding cassette sub family D (ALD) member 3|ABC43|ABCD3_HUMAN|ATP binding cassette sub family D member 3|Abcd3
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:70 kDa
- Sequence:GWDSVQDWMDVLSGGEKQRMAMARLFYHKPQFAILDECTSAVSVDVEGYIYSHCRKVGITLFTVSHRKSLWKHHEYYLHMDGRGNYEFKQITEDTVEFGS
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 560-659 of human PMP70/ABCD3 (P28288).
- Tested applications:ICC/IF
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC2131] antibody to PMP70 for WB and ICC/IF with samples derived from Human, Mouse and Rat.
- Validated Applications: WB, ICC/IF
- Recommended Dilutions: WB: 1:500 to 1:2000, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: PMP70
Clonality: Monoclonal
Clone: ARC2131
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat