Anti-MBD2 Rabbit Monoclonal Antibody [clone: ARC2691]
Catalog # ANTIA306017-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:Demethylase
- Antigen symbol:MBD2
- Clonality:Monoclonal
- Clone:ARC2691
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q9UBB5
- Antigen synonyms:MBD2a|Methyl CpG binding protein MBD2|MBD 2|MBD2|Methyl CpG binding domain protein 2|MBD2_HUMAN|Methyl-CpG-binding protein MBD2|Methyl-CpG-binding domain protein 2|DMTase
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:46 kDa
- Sequence:GGSGLGGDGGGCGGGGSGGGGAPRREPVPFPSGSAGPGPRGPRATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNT
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MBD2 (Q9UBB5).
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC2691] antibody to MBD2 for WB with samples derived from Mouse.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:1000
Type: Primary
Antigen: MBD2
Clonality: Monoclonal
Clone: ARC2691
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Mouse