Anti-Cadherin 16 Rabbit Monoclonal Antibody [clone: ARC2212]
Catalog # ANTIA305939-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:CAD16_HUMAN
- Antigen symbol:Cadherin 16
- Clonality:Monoclonal
- Clone:ARC2212
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# O75309
- Antigen synonyms:CDH16|Cadherin-16|CDH 16|Kidney specific cadherin|Cadherin 16 KSP cadherin|Cadherin 16|Kidney cadherin|Cadherin kidney|Kidney-specific cadherin
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:120 kDa
- Sequence:GAEGQIVLSGDSGKATEGPFAMDPDSGFLLVTRALDREEQAEYQLQVTLEMQDGHVLWGPQPVLVHVKDENDQVPHFSQAIYRARLSRGTRPGIPFLFLEASDRDEPGTANSDLRFHILSQAPAQPSPDMF
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 50-180 of human Cadherin 16 (O75309).
- Tested applications:ICC/IF
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC2212] antibody to Cadherin 16 for WB and ICC/IF with samples derived from Human and Mouse.
- Validated Applications: WB, ICC/IF
- Recommended Dilutions: WB: 1:500 to 1:2000, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: Cadherin 16
Clonality: Monoclonal
Clone: ARC2212
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse