Anti-Cytokeratin 17 Rabbit Monoclonal Antibody [clone: ARC0271]
ANTIA307949-100
New Product
- Antibody type:Primary
- Antigen symbol:Cytokeratin 17
- Clonality:Monoclonal
- Clone:ARC0271
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q04695
- Antigen synonyms:keratin 17 epitope S2|CK-17|Keratin|39.1|K1C17_HUMAN|keratin 17 epitope S1|Cytokeratin-17|K17|CK 17
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:48 kDa
- Sequence:MTTSIRQFTSSSSIKGSSGLGGGSSRTSCRLSGGLGAGSCRLGSAGGLGSTLGGSSYSSCYSFGSGGGYGSSFGGVDGLLAGGEKATMQNLNDRLASYLD
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 17 (KRT17) (Q04695)
- Tested applications:ICC/IF
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit monoclonal [ARC0271] antibody to Cytokeratin 17 for WB and ICC/IF with samples derived from Human, Mouse and Rat.
- Validated Applications: WB, ICC/IF
- Recommended Dilutions: WB: 1:2000 to 1:10000, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: Cytokeratin 17
Clonality: Monoclonal
Clone: ARC0271
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat