Anti-TGN46 Rabbit Monoclonal Antibody [clone: ARC2197]
Catalog # ANTIA307687-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:TGN 46
- Antigen symbol:TGN46
- Clonality:Monoclonal
- Clone:ARC2197
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# O43493
- Antigen synonyms:Trans Golgi network integral membrane protein 2|TGN38|TGN 51|TGN38 homolog|TGN51|TGN48|TGOLN2|TGON2_HUMAN|TGN46
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:90 - 100 kDa
- Sequence:MRFVVALVLLNVAAAGAVPLLATESVKQEEAGVRPSAGNVSTHPSLSQRPGGSTKSHPEPQTPKDSPSKSSAEAQTPEDTPNKSGAEAKTQKDSSNKSGA
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TGN46/TGOLN2 (O43493)
- Tested applications:IHC, ICC/IF
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC2197] antibody to TGN46 for WB, IHC and ICC/IF with samples derived from Human.
- Validated Applications: WB, IHC, ICC/IF
- Recommended Dilutions: WB: 1:500 to 1:2000, IHC: 1:50 to 1:200, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: TGN46
Clonality: Monoclonal
Clone: ARC2197
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human