Anti-CIRP Rabbit Monoclonal Antibody [clone: ARC2472]
Catalog # ANTIA307005-100
Supplier: Antibodies.com
New Product
Specifications
- Antibody type:Primary
- Antigen name:A18 hnRNP
- Antigen symbol:CIRP
- Clonality:Monoclonal
- Clone:ARC2472
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q14011
- Antigen synonyms:A18HNRNP|Cold inducible RNA binding protein|CIRP|CIRBP|testicular tissue protein Li 39|Cold-inducible RNA-binding protein|Glycine-rich RNA-binding protein CIRP|CIRBP_HUMAN|Glycine rich RNA binding protein
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:18 kDa
- Sequence:MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1-172 of human CIRBP (Q14011).
- Tested applications:IHC, ICC/IF
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC2472] antibody to CIRP for WB, IHC and ICC/IF with samples derived from Human, Mouse and Rat.
- Validated Applications: WB, IHC, ICC/IF
- Recommended Dilutions: WB: 1:500 to 1:1000, IHC: 1:50 to 1:200, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: CIRP
Clonality: Monoclonal
Clone: ARC2472
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat