Anti-RBBP4 Rabbit Monoclonal Antibody [clone: ARC0813]
ANTIA306852-100
New Product
- Antibody type:Primary
- Antigen name:CAF I p48
- Antigen symbol:RBBP4
- Clonality:Monoclonal
- Clone:ARC0813
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q09028
- Antigen synonyms:Chromatin assembly factor I p48 subunit|Nucleosome-remodeling factor subunit RBAP48|MSI1 protein homolog|CAF-I p48|CAF-I 48 kDa subunit|Chromatin assembly factor 1 subunit C|Histone-binding protein RBBP4|Chromatin assembly factor/CAF 1 p48 subunit|CAF-1 subunit C
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:52 kDa
- Sequence:MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDS
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RBBP4 (Q09028).
- Tested applications:IHC, ICC/IF
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit monoclonal [ARC0813] antibody to RBBP4 for WB, IHC and ICC/IF with samples derived from Human, Mouse and Rat.
- Validated Applications: WB, IHC, ICC/IF
- Recommended Dilutions: WB: 1:500 to 1:2000, IHC: 1:50 to 1:200, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: RBBP4
Clonality: Monoclonal
Clone: ARC0813
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat